PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr003873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 810aa    MW: 90807.9 Da    PI: 5.0744
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr003873.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS354.51.6e-1084328061373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL+ cA+avs++d++ +++lL+++++++sp+gd  qRla++f+++L+ar+a++++++    ++ +++++  +e l+a+++   ++P+ ++s +  
  Pbr003873.1 432 LRNLLILCAQAVSTNDFKSISELLKQVRQHSSPNGDGSQRLAHFFANGLEARMAGTGTGTQIFYTSLASKRTPAVEMLKAYQVHLSACPFKRMSIFFK 529
                  6899***************************************************887777666666666666************************* PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++Il+ +e+++++Hi+Df+i +G+QWp L+q L++R++gpp+lRiTg++ p++g   +e + etg+rLa+++e+++vpfe+n+++++++e+++le+L
  Pbr003873.1 530 NKMILKMAEKATTLHIVDFGILYGFQWPILIQHLSKRAGGPPKLRITGIEVPQPGfrPAEWIGETGRRLARYCERFNVPFEYNAIASQNWESIQLEDL 627
                  ******************************************************9*99***************************999********** PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  +++++E+laVn++l+ ++llde+v+++ +rd+vLkl+++++P+++v++  + +++++ F+ rf eal +ysal+d+++ ++pr++eer + E e+ gr
  Pbr003873.1 628 KTERNEVLAVNCMLRFKNLLDETVEVNCPRDAVLKLIRRMKPDIFVHSIINGSYTAPFFVSRFREALFHYSALYDAFDINIPRDNEERLMFESEFYGR 725
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  e++nv+aceg er+er et+++W+ r ++aG++ +pl++  +k  k  ++  + + + ++++s+++++gW++r +++ S+W
  Pbr003873.1 726 EAMNVIACEGVERVERPETYKQWEVRCMRAGLQLLPLDQGLVKIFKDKVKAWYHKDFVIDQDSDWMLQGWRGRIVYASSCW 806
                  *****************************************************888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.455406787IPR005202Transcription factor GRAS
PfamPF035145.7E-106432806IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 810 aa     Download sequence    Send to blast
MDHPTFNGVP DYMNGFSIDD LASSPNSSQF PNLINEYQFN QLSPDLNFMD NHFFTPPDFE  60
QGNIVPKVSV TTIGESFVPS NSLSPPDEGS FSLPNTLSPG GGDTSSDDND FSESVFKYVN  120
QILMEENIEK KPCMFYDPLG LRMTEKSFYD VLGQQYPFSP NQPPYINPNA ESPDGNISGN  180
CTDCSGSSTN SGTSNSIDPQ WVGDLGDQKS SFPQTYLPND YPFQFNSNSS SQLSVPLENG  240
VTRVGDGLRV GDEQHVDDVL QGSSVEEFVA QNIFTDSDSI FQFQRGLEEA SKFLPKSTQL  300
LVDLESNTVS PEVKAHVPIV TVKKEKSERK NSLNGSKGRK NHKREDVDLE EGRSSKQSAV  360
YLEGTQESEL SEMFDKVLLC TGGNNESQCD NVAFKNEASK TFQPNGPAQG SNGNGGKARG  420
KKQGDKKEAV DLRNLLILCA QAVSTNDFKS ISELLKQVRQ HSSPNGDGSQ RLAHFFANGL  480
EARMAGTGTG TQIFYTSLAS KRTPAVEMLK AYQVHLSACP FKRMSIFFKN KMILKMAEKA  540
TTLHIVDFGI LYGFQWPILI QHLSKRAGGP PKLRITGIEV PQPGFRPAEW IGETGRRLAR  600
YCERFNVPFE YNAIASQNWE SIQLEDLKTE RNEVLAVNCM LRFKNLLDET VEVNCPRDAV  660
LKLIRRMKPD IFVHSIINGS YTAPFFVSRF REALFHYSAL YDAFDINIPR DNEERLMFES  720
EFYGREAMNV IACEGVERVE RPETYKQWEV RCMRAGLQLL PLDQGLVKIF KDKVKAWYHK  780
DFVIDQDSDW MLQGWRGRIV YASSCWVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-414367628328GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009364376.10.0PREDICTED: scarecrow-like protein 14
RefseqXP_009364377.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WK680.0M5WK68_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s24860.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14